SCOPe 2.06: Domain d1p9sa_: 1p9s A:

Lineage for d1p9sa_ (1p9s A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species Human coronavirus 229E [TaxId:11137] [89348] (2 PDB entries)

8. Domain d1p9sa_: 1p9s A: [87999]
   complexed with dio

Details for d1p9sa_

PDB Entry: 1p9s, 2.54 Å

PDB Description: coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs

PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d1p9sa_:

Sequence; same for both SEQRES and ATOM records:

>d1p9sa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]}
aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn

Timeline for d1p9sa_:

• d1p9sa_ first appeared in SCOP 1.65
  
• d1p9sa_ appears in SCOPe 2.05
  
• d1p9sa_ appears in SCOPe 2.07
  
• d1p9sa_ appears in the current release, SCOPe 2.08