| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
| Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries) |
| Domain d1p9mc1: 1p9m C:96-195 [87995] Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_ |
PDB Entry: 1p9m (more details), 3.65 Å
SCOP Domain Sequences for d1p9mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9mc1 b.1.2.1 (C:96-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
eepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqkf
scqlavpegdssfyivsmcvassvgskfsktqtfqgcgil
Timeline for d1p9mc1:
View in 3DDomains from other chains: (mouse over for more information) d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_ |