SCOP 1.65: Domain d1p8ja1: 1p8j A:443-578

Lineage for d1p8ja1 (1p8j A:443-578)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (19 families)

5. Family b.18.1.20: Proprotein convertase P-domain [89249] (2 proteins)
   a truncated form of this fold lacking one of the N-terminal strands

6. Protein Furin, C-terminal domain [89252] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89253] (1 PDB entry)

8. Domain d1p8ja1: 1p8j A:443-578 [87946]
   Other proteins in same PDB: d1p8ja2, d1p8jb2, d1p8jc2, d1p8jd2, d1p8je2, d1p8jf2, d1p8jg2, d1p8jh2

Details for d1p8ja1

PDB Entry: 1p8j, 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin

SCOP Domain Sequences for d1p8ja1:

Sequence; same for both SEQRES and ATOM records:

>d1p8ja1 b.18.1.20 (A:443-578) Furin, C-terminal domain {Mouse (Mus musculus)}
tvapqrkciveilvepkdigkrlevrkavtaclgepnhitrlehvqarltlsynrrgdla
ihlispmgtrstllaarphdysadgfndwafmtthswdedpagewvleientseannygt
ltkftlvlygtapegl

Timeline for d1p8ja1:

• d1p8ja1 is new in SCOP 1.65
  
• d1p8ja1 appears in SCOP 1.67
  
• d1p8ja1 appears in the current release, SCOPe 2.08