Lineage for d1p8je2 (1p8j E:109-442)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 314784Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 314785Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 314786Family c.41.1.1: Subtilases [52744] (10 proteins)
  6. 314787Protein Furin, N-terminal domain [89694] (1 species)
  7. 314788Species Mouse (Mus musculus) [TaxId:10090] [89695] (1 PDB entry)
  8. 314793Domain d1p8je2: 1p8j E:109-442 [87955]
    Other proteins in same PDB: d1p8ja1, d1p8jb1, d1p8jc1, d1p8jd1, d1p8je1, d1p8jf1, d1p8jg1, d1p8jh1

Details for d1p8je2

PDB Entry: 1p8j (more details), 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin

SCOP Domain Sequences for d1p8je2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8je2 c.41.1.1 (E:109-442) Furin, N-terminal domain {Mouse (Mus musculus)}
vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
ddwatngvgrkvshsygyglldagamvalaqnwt

SCOP Domain Coordinates for d1p8je2:

Click to download the PDB-style file with coordinates for d1p8je2.
(The format of our PDB-style files is described here.)

Timeline for d1p8je2: