Lineage for d1p71b_ (1p71 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328278Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2328279Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2328280Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2328281Protein HU protein [47735] (5 species)
  7. 2328282Species Anabaena sp. [TaxId:1167] [89074] (3 PDB entries)
  8. 2328284Domain d1p71b_: 1p71 B: [87841]
    protein/DNA complex

Details for d1p71b_

PDB Entry: 1p71 (more details), 1.9 Å

PDB Description: Anabaena HU-DNA corcrystal structure (TR3)
PDB Compounds: (B:) DNA-binding protein HU

SCOPe Domain Sequences for d1p71b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p71b_ a.55.1.1 (B:) HU protein {Anabaena sp. [TaxId: 1167]}
mnkgelvdavaekasvtkkqadavltaaletiieavssgdkvtlvgfgsfesrerkareg
rnpktnekmeipatrvpafsagklfrekvappk

SCOPe Domain Coordinates for d1p71b_:

Click to download the PDB-style file with coordinates for d1p71b_.
(The format of our PDB-style files is described here.)

Timeline for d1p71b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p71a_