| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries) Uniprot P20248 175-432 |
| Domain d1p5ed1: 1p5e D:175-309 [87800] Other proteins in same PDB: d1p5ea1, d1p5ea2, d1p5ec1, d1p5ec2 complexed with tbs |
PDB Entry: 1p5e (more details), 2.22 Å
SCOPe Domain Sequences for d1p5ed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5ed1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap
Timeline for d1p5ed1: