![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Arginine kinase, N-domain [48042] (2 species) |
![]() | Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (14 PDB entries) Uniprot P51541 |
![]() | Domain d1p52a1: 1p52 A:2-95 [87792] Other proteins in same PDB: d1p52a2 complexed with adp, dar, mg, no3; mutant |
PDB Entry: 1p52 (more details), 1.9 Å
SCOPe Domain Sequences for d1p52a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p52a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl dsgvgiyapdaesyrtfgplfdpiiddyhggfkl
Timeline for d1p52a1: