SCOPe 2.01: Domain d1p3da2: 1p3d A:322-473

Lineage for d1p3da2 (1p3d A:322-473)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries)

8. Domain d1p3da2: 1p3d A:322-473 [87729]
   Other proteins in same PDB: d1p3da1, d1p3da3, d1p3db1, d1p3db3
   complexed with anp, mn, uma

Details for d1p3da2

PDB Entry: 1p3d, 1.7 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine ligase (MurC) in Complex with UMA and ANP.

PDB Compounds: (A:) UDP-N-acetylmuramate--alanine ligase

SCOPe Domain Sequences for d1p3da2:

Sequence; same for both SEQRES and ATOM records:

>d1p3da2 c.59.1.1 (A:322-473) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt
rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg
dvldqiiqdgdlilaqgagsvskisrglaesw

Timeline for d1p3da2:

• d1p3da2 first appeared in SCOP 1.65
  
• d1p3da2 appears in SCOP 1.75
  
• d1p3da2 appears in SCOPe 2.02
  
• d1p3da2 appears in the current release, SCOPe 2.08