SCOPe 2.02: Domain d1p31b2: 1p31 B:322-473

Lineage for d1p31b2 (1p31 B:322-473)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries)

8. Domain d1p31b2: 1p31 B:322-473 [87726]
   Other proteins in same PDB: d1p31a1, d1p31a3, d1p31b1, d1p31b3
   complexed with epu, mg

Details for d1p31b2

PDB Entry: 1p31, 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae

PDB Compounds: (B:) UDP-N-acetylmuramate--alanine ligase

SCOPe Domain Sequences for d1p31b2:

Sequence; same for both SEQRES and ATOM records:

>d1p31b2 c.59.1.1 (B:322-473) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt
rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg
dvldqiiqdgdlilaqgagsvskisrglaesw

Timeline for d1p31b2:

• d1p31b2 first appeared in SCOP 1.65
  
• d1p31b2 appears in SCOPe 2.01
  
• d1p31b2 appears in SCOPe 2.03
  
• d1p31b2 appears in the current release, SCOPe 2.08