Lineage for d1p31a2 (1p31 A:322-474)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588053Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 588054Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 588055Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 588060Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species)
  7. 588061Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries)
  8. 588066Domain d1p31a2: 1p31 A:322-474 [87723]
    Other proteins in same PDB: d1p31a1, d1p31a3, d1p31b1, d1p31b3

Details for d1p31a2

PDB Entry: 1p31 (more details), 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae

SCOP Domain Sequences for d1p31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p31a2 c.59.1.1 (A:322-474) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt
rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg
dvldqiiqdgdlilaqgagsvskisrglaeswk

SCOP Domain Coordinates for d1p31a2:

Click to download the PDB-style file with coordinates for d1p31a2.
(The format of our PDB-style files is described here.)

Timeline for d1p31a2: