Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) |
Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins) |
Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species) |
Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries) |
Domain d1p31a2: 1p31 A:322-474 [87723] Other proteins in same PDB: d1p31a1, d1p31a3, d1p31b1, d1p31b3 complexed with epu, mg |
PDB Entry: 1p31 (more details), 1.85 Å
SCOPe Domain Sequences for d1p31a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p31a2 c.59.1.1 (A:322-474) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg dvldqiiqdgdlilaqgagsvskisrglaeswk
Timeline for d1p31a2: