Lineage for d1p31a1 (1p31 A:12-106)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823156Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 823157Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 823158Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 823159Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 823160Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries)
  8. 823163Domain d1p31a1: 1p31 A:12-106 [87722]
    Other proteins in same PDB: d1p31a2, d1p31a3, d1p31b2, d1p31b3

Details for d1p31a1

PDB Entry: 1p31 (more details), 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae
PDB Compounds: (A:) UDP-N-acetylmuramate--alanine ligase

SCOP Domain Sequences for d1p31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p31a1 c.5.1.1 (A:12-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
ipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyigha
eehiegasvvvvssaikddnpelvtskqkripviq

SCOP Domain Coordinates for d1p31a1:

Click to download the PDB-style file with coordinates for d1p31a1.
(The format of our PDB-style files is described here.)

Timeline for d1p31a1: