SCOPe 2.08: Domain d1p31a1: 1p31 A:12-106

Lineage for d1p31a1 (1p31 A:12-106)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families)

5. Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)

6. Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries)

8. Domain d1p31a1: 1p31 A:12-106 [87722]
   Other proteins in same PDB: d1p31a2, d1p31a3, d1p31b2, d1p31b3
   complexed with epu, mg

Details for d1p31a1

PDB Entry: 1p31, 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae

PDB Compounds: (A:) UDP-N-acetylmuramate--alanine ligase

SCOPe Domain Sequences for d1p31a1:

Sequence; same for both SEQRES and ATOM records:

>d1p31a1 c.5.1.1 (A:12-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
ipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyigha
eehiegasvvvvssaikddnpelvtskqkripviq

Timeline for d1p31a1:

• d1p31a1 first appeared in SCOP 1.65
  
• d1p31a1 appears in SCOPe 2.07