Lineage for d1p1rd1 (1p1r D:1-163,D:340-374)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296128Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 296129Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 296179Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (7 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 296191Protein Alcohol dehydrogenase [50137] (6 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 296202Species Horse (Equus caballus) [TaxId:9796] [50138] (31 PDB entries)
  8. 296218Domain d1p1rd1: 1p1r D:1-163,D:340-374 [87709]
    Other proteins in same PDB: d1p1ra2, d1p1rb2, d1p1rc2, d1p1rd2
    complexed with mpd, naj, nmh, zn

Details for d1p1rd1

PDB Entry: 1p1r (more details), 1.57 Å

PDB Description: Horse liver alcohol dehydrogenase complexed with NADH and R-N-1-methylhexylformamide

SCOP Domain Sequences for d1p1rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1rd1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOP Domain Coordinates for d1p1rd1:

Click to download the PDB-style file with coordinates for d1p1rd1.
(The format of our PDB-style files is described here.)

Timeline for d1p1rd1: