Lineage for d1p1rb2 (1p1r B:164-339)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 307889Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
    N-terminal all-beta domain defines family
  6. 307901Protein Alcohol dehydrogenase [51737] (6 species)
  7. 307912Species Horse (Equus caballus) [TaxId:9796] [51738] (31 PDB entries)
  8. 307926Domain d1p1rb2: 1p1r B:164-339 [87706]
    Other proteins in same PDB: d1p1ra1, d1p1rb1, d1p1rc1, d1p1rd1

Details for d1p1rb2

PDB Entry: 1p1r (more details), 1.57 Å

PDB Description: Horse liver alcohol dehydrogenase complexed with NADH and R-N-1-methylhexylformamide

SCOP Domain Sequences for d1p1rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1rb2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus)}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOP Domain Coordinates for d1p1rb2:

Click to download the PDB-style file with coordinates for d1p1rb2.
(The format of our PDB-style files is described here.)

Timeline for d1p1rb2: