SCOPe 2.07: Domain d1p1ib2: 1p1i B:323-437

Lineage for d1p1ib2 (1p1i B:323-437)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Myo-inositol 1-phosphate synthase [75484] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
   Uniprot P11986

8. Domain d1p1ib2: 1p1i B:323-437 [87686]
   Other proteins in same PDB: d1p1ia1, d1p1ib1
   complexed with nad

Details for d1p1ib2

PDB Entry: 1p1i, 2.4 Å

PDB Description: Crystal structure of the NAD+-bound 1L-myo-inositol 1-phosphate synthase

PDB Compounds: (B:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1p1ib2:

Sequence, based on SEQRES records:

>d1p1ib2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records):

>d1p1ib2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgiiasndilyndklgkkvdhcivikymkpv
gdskvamdeyyselmlgghnrisihnvce

Timeline for d1p1ib2:

• d1p1ib2 first appeared in SCOP 1.65
  
• d1p1ib2 appears in SCOPe 2.06
  
• d1p1ib2 appears in the current release, SCOPe 2.08