| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) ![]() |
| Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
| Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
| Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries) |
| Domain d1ozvc1: 1ozv C:311-488 [87636] Other proteins in same PDB: d1ozva2, d1ozvb2, d1ozvc2 complexed with lys, sah |
PDB Entry: 1ozv (more details), 2.65 Å
SCOP Domain Sequences for d1ozvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozvc1 a.166.1.1 (C:311-488) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyfq
Timeline for d1ozvc1:
View in 3DDomains from other chains: (mouse over for more information) d1ozva1, d1ozva2, d1ozvb1, d1ozvb2 |