SCOP 1.65: Domain d1ozvc1: 1ozv C:311-488

Lineage for d1ozvc1 (1ozv C:311-488)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family)

5. Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)

6. Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries)

8. Domain d1ozvc1: 1ozv C:311-488 [87636]
   Other proteins in same PDB: d1ozva2, d1ozvb2, d1ozvc2
   complexed with lys, sah

Details for d1ozvc1

PDB Entry: 1ozv, 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy

SCOP Domain Sequences for d1ozvc1:

Sequence; same for both SEQRES and ATOM records:

>d1ozvc1 a.166.1.1 (C:311-488) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyfq

Timeline for d1ozvc1:

• d1ozvc1 is new in SCOP 1.65
  
• d1ozvc1 appears in SCOP 1.67
  
• d1ozvc1 appears in the current release, SCOPe 2.08