Lineage for d1ozvc1 (1ozv C:311-482)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735757Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2735758Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 2735759Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 2735760Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 2735761Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries)
  8. 2735767Domain d1ozvc1: 1ozv C:311-482 [87636]
    Other proteins in same PDB: d1ozva2, d1ozva3, d1ozvb2, d1ozvb3, d1ozvc2, d1ozvc3
    complexed with lys, sah

Details for d1ozvc1

PDB Entry: 1ozv (more details), 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy
PDB Compounds: (C:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast

SCOPe Domain Sequences for d1ozvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozvc1 a.166.1.1 (C:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil

SCOPe Domain Coordinates for d1ozvc1:

Click to download the PDB-style file with coordinates for d1ozvc1.
(The format of our PDB-style files is described here.)

Timeline for d1ozvc1: