SCOPe 2.04: Domain d1ozti_: 1ozt I:

Lineage for d1ozti_ (1ozt I:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (71 PDB entries)

8. Domain d1ozti_: 1ozt I: [87624]
   mutant

Details for d1ozti_

PDB Entry: 1ozt, 2.5 Å

PDB Description: crystal structure of apo-h46r familial als mutant human cu,zn superoxide dismutase (cuznsod) to 2.5a resolution

PDB Compounds: (I:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1ozti_:

Sequence, based on SEQRES records:

>d1ozti_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d1ozti_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgkgg
negsrlacgvigiaq

Timeline for d1ozti_:

• d1ozti_ first appeared in SCOP 1.65
  
• d1ozti_ appears in SCOPe 2.03
  
• d1ozti_ appears in SCOPe 2.05
  
• d1ozti_ appears in the current release, SCOPe 2.08