Lineage for d1ozna_ (1ozn A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980294Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 980347Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 980456Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 980471Protein Reticulon 4 receptor (Nogo-66 receptor, Ngr) [89567] (1 species)
  7. 980472Species Human (Homo sapiens) [TaxId:9606] [89568] (2 PDB entries)
  8. 980473Domain d1ozna_: 1ozn A: [87621]
    complexed with acy

Details for d1ozna_

PDB Entry: 1ozn (more details), 1.52 Å

PDB Description: 1.5a crystal structure of the nogo receptor ligand binding domain reveals a convergent recognition scaffold mediating inhibition of myelination
PDB Compounds: (A:) Reticulon 4 receptor

SCOPe Domain Sequences for d1ozna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}
pcpgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnlti
lwlhsnvlaridaaaftglalleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqel
gpglfrglaalqylylqdnalqalpddtfrdlgnlthlflhgnrissvperafrglhsld
rlllhqnrvahvhphafrdlgrlmtlylfannlsalptealaplralqylrlndnpwvcd
crarplwawlqkfrgsssevpcslpqrlagrdlkrlaandlqgc

SCOPe Domain Coordinates for d1ozna_:

Click to download the PDB-style file with coordinates for d1ozna_.
(The format of our PDB-style files is described here.)

Timeline for d1ozna_: