Lineage for d1oynb_ (1oyn B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1285765Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1285825Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 1285826Species Human (Homo sapiens) [TaxId:9606] [89152] (32 PDB entries)
    Uniprot Q08499 388-713
  8. 1285875Domain d1oynb_: 1oyn B: [87610]
    complexed with rol, zn

Details for d1oynb_

PDB Entry: 1oyn (more details), 2 Å

PDB Description: Crystal structure of PDE4D2 in complex with (R,S)-rolipram
PDB Compounds: (B:) cAMP-specific phosphodiesterase PDE4D2

SCOPe Domain Sequences for d1oynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oynb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d1oynb_:

Click to download the PDB-style file with coordinates for d1oynb_.
(The format of our PDB-style files is described here.)

Timeline for d1oynb_: