Lineage for d1oyna_ (1oyn A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 927893Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 927926Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 927927Species Human (Homo sapiens) [TaxId:9606] [89152] (25 PDB entries)
    Uniprot Q08499 388-713
  8. 927960Domain d1oyna_: 1oyn A: [87609]
    complexed with rol, zn

Details for d1oyna_

PDB Entry: 1oyn (more details), 2 Å

PDB Description: Crystal structure of PDE4D2 in complex with (R,S)-rolipram
PDB Compounds: (A:) cAMP-specific phosphodiesterase PDE4D2

SCOPe Domain Sequences for d1oyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyna_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d1oyna_:

Click to download the PDB-style file with coordinates for d1oyna_.
(The format of our PDB-style files is described here.)

Timeline for d1oyna_: