| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
| Protein Class tau GST [81365] (2 species) |
| Species Rice (Oryza sativa) [TaxId:4530] [89706] (1 PDB entry) |
| Domain d1oyjc2: 1oyj C:3-85 [87602] Other proteins in same PDB: d1oyja1, d1oyjb1, d1oyjc1, d1oyjd1 |
PDB Entry: 1oyj (more details), 1.95 Å
SCOP Domain Sequences for d1oyjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyjc2 c.47.1.5 (C:3-85) Class tau GST {Rice (Oryza sativa)}
eekelvlldfwvspfgqrcriamaekglefeyreedlgnksdlllrsnpvhrkipvllha
grpvseslvilqylddafpgtph
Timeline for d1oyjc2: