SCOP 1.65: Domain d1oyjc2: 1oyj C:3-85

Lineage for d1oyjc2 (1oyj C:3-85)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class tau GST [81365] (2 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [89706] (1 PDB entry)

8. Domain d1oyjc2: 1oyj C:3-85 [87602]
   Other proteins in same PDB: d1oyja1, d1oyjb1, d1oyjc1, d1oyjd1

Details for d1oyjc2

PDB Entry: 1oyj, 1.95 Å

PDB Description: Crystal structure solution of Rice GST1 (OsGSTU1) in complex with glutathione.

SCOP Domain Sequences for d1oyjc2:

Sequence; same for both SEQRES and ATOM records:

>d1oyjc2 c.47.1.5 (C:3-85) Class tau GST {Rice (Oryza sativa)}
eekelvlldfwvspfgqrcriamaekglefeyreedlgnksdlllrsnpvhrkipvllha
grpvseslvilqylddafpgtph

Timeline for d1oyjc2:

• d1oyjc2 is new in SCOP 1.65
  
• d1oyjc2 appears in SCOP 1.67
  
• d1oyjc2 appears in the current release, SCOPe 2.08