Lineage for d1oyja1 (1oyj A:86-230)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356318Protein Class tau GST [81354] (2 species)
  7. 356319Species Rice (Oryza sativa) [TaxId:4530] [89062] (1 PDB entry)
  8. 356320Domain d1oyja1: 1oyj A:86-230 [87597]
    Other proteins in same PDB: d1oyja2, d1oyjb2, d1oyjc2, d1oyjd2

Details for d1oyja1

PDB Entry: 1oyj (more details), 1.95 Å

PDB Description: Crystal structure solution of Rice GST1 (OsGSTU1) in complex with glutathione.

SCOP Domain Sequences for d1oyja1:

Sequence, based on SEQRES records: (download)

>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa)}
llppansgdadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtle
aelgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrid
svvkhlpspekvydfvgvlkkkygv

Sequence, based on observed residues (ATOM records): (download)

>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa)}
llppansgadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtlea
elgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrids
vvkhlpspekvydfvgvlkkkygv

SCOP Domain Coordinates for d1oyja1:

Click to download the PDB-style file with coordinates for d1oyja1.
(The format of our PDB-style files is described here.)

Timeline for d1oyja1: