Lineage for d1oy1b_ (1oy1 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 984114Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 984253Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 984347Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species)
    involved in an early stage of isoprenoid biosynthesis; contains a Cys-Glu putative catalytic dyad
  7. 984348Species Escherichia coli [TaxId:562] [89607] (2 PDB entries)
  8. 984352Domain d1oy1b_: 1oy1 B: [87549]
    structural genomics; NESG target ER105

Details for d1oy1b_

PDB Entry: 1oy1 (more details), 2.95 Å

PDB Description: X-Ray Structure Of ElbB From E. Coli. Northeast Structural Genomics Research Consortium (Nesg) Target Er105
PDB Compounds: (B:) PUTATIVE sigma cross-reacting protein 27A

SCOPe Domain Sequences for d1oy1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy1b_ c.23.16.2 (B:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]}
tmkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamte
trnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelka
laqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddiv
vdednkivttpaymlaqniaeaasgidklvsrvlvlael

SCOPe Domain Coordinates for d1oy1b_:

Click to download the PDB-style file with coordinates for d1oy1b_.
(The format of our PDB-style files is described here.)

Timeline for d1oy1b_: