| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein RNA-binding protein Smaug [89075] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89076] (1 PDB entry) |
| Domain d1oxja1: 1oxj A:594-655 [87517] Other proteins in same PDB: d1oxja2 |
PDB Entry: 1oxj (more details), 1.8 Å
SCOPe Domain Sequences for d1oxja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hmvgmsgiglwlkslrlhkyielfknmtyeemllitedflqsvgvtkgashklalcidkl
ke
Timeline for d1oxja1: