Lineage for d1oxja1 (1oxj A:594-655)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282278Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 282294Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (5 proteins)
  6. 282318Protein RNA-binding protein Smaug [89075] (1 species)
  7. 282319Species Drosophila melanogaster [TaxId:7227] [89076] (1 PDB entry)
  8. 282320Domain d1oxja1: 1oxj A:594-655 [87517]
    Other proteins in same PDB: d1oxja2

Details for d1oxja1

PDB Entry: 1oxj (more details), 1.8 Å

PDB Description: Crystal structure of the Smaug RNA binding domain

SCOP Domain Sequences for d1oxja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster}
hmvgmsgiglwlkslrlhkyielfknmtyeemllitedflqsvgvtkgashklalcidkl
ke

SCOP Domain Coordinates for d1oxja1:

Click to download the PDB-style file with coordinates for d1oxja1.
(The format of our PDB-style files is described here.)

Timeline for d1oxja1:

282320
d1oxja1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1oxja2