Lineage for d1oxja2 (1oxj A:656-763)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 285066Family a.118.1.13: PHAT domain [89129] (1 protein)
    pseudo-HEAT repeat
    this is a repeat family; one repeat unit is 1oxj A:672-722 found in domain
  6. 285067Protein RNA-binding protein Smaug [89130] (1 species)
  7. 285068Species Drosophila melanogaster [TaxId:7227] [89131] (1 PDB entry)
  8. 285069Domain d1oxja2: 1oxj A:656-763 [87518]
    Other proteins in same PDB: d1oxja1

Details for d1oxja2

PDB Entry: 1oxj (more details), 1.8 Å

PDB Description: Crystal structure of the Smaug RNA binding domain

SCOP Domain Sequences for d1oxja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxja2 a.118.1.13 (A:656-763) RNA-binding protein Smaug {Drosophila melanogaster}
ranilnrveqellsgqmelstaveeltnivltpmkplespgppeeniglrflkvidivtn
tlqqdpyavqddetlgvlmwildrsihneafmnhasqlkdlkfklskm

SCOP Domain Coordinates for d1oxja2:

Click to download the PDB-style file with coordinates for d1oxja2.
(The format of our PDB-style files is described here.)

Timeline for d1oxja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oxja1