| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins) contains a catalytic Cys-His-Glu triad |
| Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries) |
| Domain d1ox5b2: 1ox5 B:3-229 [87504] Other proteins in same PDB: d1ox5a1, d1ox5b1 |
PDB Entry: 1ox5 (more details), 2.5 Å
SCOP Domain Sequences for d1ox5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox5b2 c.23.16.1 (B:3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
vvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfvdnlfn
rgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsekpvpei
gwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygseefiaav
nknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn
Timeline for d1ox5b2: