Lineage for d1ox5a2 (1ox5 A:-3-229)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 481898Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 481968Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 481969Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries)
  8. 481976Domain d1ox5a2: 1ox5 A:-3-229 [87502]
    Other proteins in same PDB: d1ox5a1, d1ox5b1

Details for d1ox5a2

PDB Entry: 1ox5 (more details), 2.5 Å

PDB Description: towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase

SCOP Domain Sequences for d1ox5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox5a2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv
dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek
pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee
fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

SCOP Domain Coordinates for d1ox5a2:

Click to download the PDB-style file with coordinates for d1ox5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ox5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ox5a1