Lineage for d1ox4b2 (1ox4 B:1-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858826Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (4 species)
  7. 2858827Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries)
  8. 2858835Domain d1ox4b2: 1ox4 B:1-229 [87500]
    Other proteins in same PDB: d1ox4a1, d1ox4a3, d1ox4b1, d1ox4b3
    complexed with ni, pop, so4

Details for d1ox4b2

PDB Entry: 1ox4 (more details), 2.5 Å

PDB Description: towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase
PDB Compounds: (B:) Imidazole glycerol phosphate synthase hisHF

SCOPe Domain Sequences for d1ox4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox4b2 c.23.16.1 (B:1-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
mpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfvdnl
fnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsekpvp
eigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygseefia
avnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

SCOPe Domain Coordinates for d1ox4b2:

Click to download the PDB-style file with coordinates for d1ox4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ox4b2: