SCOPe 2.04: Domain d1owgb_: 1owg B:

Lineage for d1owgb_ (1owg B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
   heterodimer of two related subunits

7. Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)

8. Domain d1owgb_: 1owg B: [87490]
   Other proteins in same PDB: d1owga_
   protein/DNA complex

Details for d1owgb_

PDB Entry: 1owg, 2.1 Å

PDB Description: Crystal structure of WT IHF complexed with an altered H' site (T44A)

PDB Compounds: (B:) Integration host factor beta-subunit

SCOPe Domain Sequences for d1owgb_:

Sequence; same for both SEQRES and ATOM records:

>d1owgb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

Timeline for d1owgb_:

• d1owgb_ first appeared in SCOP 1.65
  
• d1owgb_ appears in SCOPe 2.03
  
• d1owgb_ appears in SCOPe 2.05
  
• d1owgb_ appears in the current release, SCOPe 2.08