Lineage for d1ow0d1 (1ow0 D:6-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2365043Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2365044Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)
  8. 2365053Domain d1ow0d1: 1ow0 D:6-100 [87483]
    Other proteins in same PDB: d1ow0a1, d1ow0a2, d1ow0b1, d1ow0b2
    complexed with IgA1 Fc
    complexed with nag

Details for d1ow0d1

PDB Entry: 1ow0 (more details), 3.1 Å

PDB Description: crystal structure of human fcari bound to iga1-fc
PDB Compounds: (D:) Immunoglobulin alpha Fc receptor

SCOPe Domain Sequences for d1ow0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow0d1 b.1.1.4 (D:6-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
pmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnetdpefv
idhmdankagryqcqyrighyrfrysdtlelvvtg

SCOPe Domain Coordinates for d1ow0d1:

Click to download the PDB-style file with coordinates for d1ow0d1.
(The format of our PDB-style files is described here.)

Timeline for d1ow0d1: