Lineage for d1ouzb_ (1ouz B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539168Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 539169Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) (S)
    dimer of identical subunits
  5. 539170Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 539199Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
    heterodimer of two related subunits
  7. 539200Species Escherichia coli [TaxId:562] [88881] (4 PDB entries)
  8. 539204Domain d1ouzb_: 1ouz B: [87450]
    Other proteins in same PDB: d1ouza_
    mutant

Details for d1ouzb_

PDB Entry: 1ouz (more details), 2.41 Å

PDB Description: crystal structure of a mutant ihf (betae44a) complexed with a variant h' site (t44a)

SCOP Domain Sequences for d1ouzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouzb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli}
mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

SCOP Domain Coordinates for d1ouzb_:

Click to download the PDB-style file with coordinates for d1ouzb_.
(The format of our PDB-style files is described here.)

Timeline for d1ouzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ouza_