SCOP 1.65: Domain d1ouzb_: 1ouz B:

Lineage for d1ouzb_ (1ouz B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)

6. Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
   heterodimer of two related subunits

7. Species Escherichia coli [TaxId:562] [88881] (4 PDB entries)

8. Domain d1ouzb_: 1ouz B: [87450]
   Other proteins in same PDB: d1ouza_
   mutant

Details for d1ouzb_

PDB Entry: 1ouz, 2.41 Å

PDB Description: crystal structure of a mutant ihf (betae44a) complexed with a variant h' site (t44a)

SCOP Domain Sequences for d1ouzb_:

Sequence; same for both SEQRES and ATOM records:

>d1ouzb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli}
mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

Timeline for d1ouzb_:

• d1ouzb_ is new in SCOP 1.65
  
• d1ouzb_ appears in SCOP 1.67
  
• d1ouzb_ appears in the current release, SCOPe 2.08