Lineage for d1ot3b_ (1ot3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474106Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 2474107Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 2474131Domain d1ot3b_: 1ot3 B: [87401]
    complexed with so4, thm

Details for d1ot3b_

PDB Entry: 1ot3 (more details), 2.5 Å

PDB Description: Crystal structure of Drosophila deoxyribonucleotide kinase complexed with the substrate deoxythymidine
PDB Compounds: (B:) Deoxyribonucleoside kinase

SCOPe Domain Sequences for d1ot3b_:

Sequence, based on SEQRES records: (download)

>d1ot3b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d1ot3b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqckvlvldad

SCOPe Domain Coordinates for d1ot3b_:

Click to download the PDB-style file with coordinates for d1ot3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ot3b_: