![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Deoxyribonucleoside kinase [69478] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries) |
![]() | Domain d1ot3b_: 1ot3 B: [87401] complexed with so4, thm |
PDB Entry: 1ot3 (more details), 2.5 Å
SCOPe Domain Sequences for d1ot3b_:
Sequence, based on SEQRES records: (download)
>d1ot3b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqrrpqsckvlvldad
>d1ot3b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqckvlvldad
Timeline for d1ot3b_: