Lineage for d1or7f_ (1or7 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752793Fold a.180: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89068] (1 superfamily)
    4 helices; irregular array
  4. 1752794Superfamily a.180.1: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89069] (1 family) (S)
    automatically mapped to Pfam PF03872
  5. 1752795Family a.180.1.1: N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89070] (1 protein)
  6. 1752796Protein N-terminal, cytoplasmic domain of anti-sigmaE factor RseA [89071] (1 species)
  7. 1752797Species Escherichia coli [TaxId:562] [89072] (1 PDB entry)
  8. 1752799Domain d1or7f_: 1or7 F: [87337]
    Other proteins in same PDB: d1or7a1, d1or7a2, d1or7b1, d1or7b2

Details for d1or7f_

PDB Entry: 1or7 (more details), 2 Å

PDB Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA
PDB Compounds: (F:) Sigma-E factor negative regulatory protein

SCOPe Domain Sequences for d1or7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or7f_ a.180.1.1 (F:) N-terminal, cytoplasmic domain of anti-sigmaE factor RseA {Escherichia coli [TaxId: 562]}
mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
aaie

SCOPe Domain Coordinates for d1or7f_:

Click to download the PDB-style file with coordinates for d1or7f_.
(The format of our PDB-style files is described here.)

Timeline for d1or7f_: