Lineage for d1or7a1 (1or7 A:120-187)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480774Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1480807Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1480845Protein SigmaE factor (RpoE) [88993] (1 species)
  7. 1480846Species Escherichia coli [TaxId:562] [88994] (2 PDB entries)
  8. 1480847Domain d1or7a1: 1or7 A:120-187 [87332]
    Other proteins in same PDB: d1or7a2, d1or7b2, d1or7c_, d1or7f_

Details for d1or7a1

PDB Entry: 1or7 (more details), 2 Å

PDB Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA
PDB Compounds: (A:) RNA polymerase sigma-E factor

SCOPe Domain Sequences for d1or7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]}
nlmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrare
aidnkvqp

SCOPe Domain Coordinates for d1or7a1:

Click to download the PDB-style file with coordinates for d1or7a1.
(The format of our PDB-style files is described here.)

Timeline for d1or7a1: