SCOPe 2.08: Domain d1opja1: 1opj A:248-529

Lineage for d1opja1 (1opj A:248-529)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries)

8. Domain d1opja1: 1opj A:248-529 [87230]
   Other proteins in same PDB: d1opja2, d1opjb2
   complexed with cl, myr, sti

Details for d1opja1

PDB Entry: 1opj, 1.75 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d1opja1:

Sequence; same for both SEQRES and ATOM records:

>d1opja1 d.144.1.7 (A:248-529) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekel

Timeline for d1opja1:

• d1opja1 first appeared in SCOP 1.65, called d1opja_
  
• d1opja1 appears in SCOPe 2.07