Lineage for d1opja1 (1opj A:248-529)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979723Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979737Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries)
  8. 2979741Domain d1opja1: 1opj A:248-529 [87230]
    Other proteins in same PDB: d1opja2, d1opjb2
    complexed with cl, myr, sti

Details for d1opja1

PDB Entry: 1opj (more details), 1.75 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d1opja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opja1 d.144.1.7 (A:248-529) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekel

SCOPe Domain Coordinates for d1opja1:

Click to download the PDB-style file with coordinates for d1opja1.
(The format of our PDB-style files is described here.)

Timeline for d1opja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1opja2