Lineage for d1opja_ (1opj A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334933Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 334934Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 334971Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins)
    members organised in the groups and subfamiles specified by the comments
  6. 334975Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 334976Species Mouse (Mus musculus) [TaxId:10090] [56167] (6 PDB entries)
  8. 334977Domain d1opja_: 1opj A: [87230]

Details for d1opja_

PDB Entry: 1opj (more details), 1.75 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase

SCOP Domain Sequences for d1opja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
amdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllym
atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
cpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekel

SCOP Domain Coordinates for d1opja_:

Click to download the PDB-style file with coordinates for d1opja_.
(The format of our PDB-style files is described here.)

Timeline for d1opja_: