Lineage for d1op8b_ (1op8 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 561910Protein Granzyme A [89345] (1 species)
  7. 561911Species Human (Homo sapiens) [TaxId:9606] [89346] (2 PDB entries)
  8. 561914Domain d1op8b_: 1op8 B: [87225]

Details for d1op8b_

PDB Entry: 1op8 (more details), 2.5 Å

PDB Description: Crystal Structure of Human Granzyme A

SCOP Domain Sequences for d1op8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op8b_ b.47.1.2 (B:) Granzyme A {Human (Homo sapiens)}
iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
qvagwgrthnsaswsdtlrevnitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikgav

SCOP Domain Coordinates for d1op8b_:

Click to download the PDB-style file with coordinates for d1op8b_.
(The format of our PDB-style files is described here.)

Timeline for d1op8b_: