| Class b: All beta proteins [48724] (149 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
| Protein Granzyme A [89345] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89346] (2 PDB entries) |
| Domain d1op8a_: 1op8 A: [87224] |
PDB Entry: 1op8 (more details), 2.5 Å
SCOP Domain Sequences for d1op8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op8a_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens)}
iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
qvagwgrthnsaswsdtlrevnitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikgav
Timeline for d1op8a_: