SCOP 1.71: Domain d1ooqa_: 1ooq A:

Lineage for d1ooqa_ (1ooq A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (3 proteins)

6. Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (3 species)

7. Species Escherichia coli, minor form, NfnB [TaxId:562] [55478] (9 PDB entries)

8. Domain d1ooqa_: 1ooq A: [87206]

Details for d1ooqa_

PDB Entry: 1ooq, 2 Å

PDB Description: Nitroreductase from e-coli in complex with the inhibitor dicoumarol

SCOP Domain Sequences for d1ooqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ooqa_ d.90.1.1 (A:) Oxygen-insensitive NAD(P)H nitroreductase {Escherichia coli, minor form, NfnB}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

Timeline for d1ooqa_:

• d1ooqa_ first appeared in SCOP 1.65
  
• d1ooqa_ appears in SCOP 1.69
  
• d1ooqa_ appears in SCOP 1.73
  
• d1ooqa_ appears in the current release, SCOPe 2.08