Lineage for d1ooqa_ (1ooq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963324Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (4 species)
  7. 2963358Species Escherichia coli, minor form, NfnB [TaxId:562] [55478] (9 PDB entries)
  8. 2963365Domain d1ooqa_: 1ooq A: [87206]
    complexed with dtc, fmn

Details for d1ooqa_

PDB Entry: 1ooq (more details), 2 Å

PDB Description: Nitroreductase from e-coli in complex with the inhibitor dicoumarol
PDB Compounds: (A:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d1ooqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooqa_ d.90.1.1 (A:) Oxygen-insensitive NAD(P)H nitroreductase {Escherichia coli, minor form, NfnB [TaxId: 562]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d1ooqa_:

Click to download the PDB-style file with coordinates for d1ooqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ooqa_: