SCOPe 2.03: Domain d1ookg_: 1ook G:

Lineage for d1ookg_ (1ook G:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)

8. Domain d1ookg_: 1ook G: [87200]
   Other proteins in same PDB: d1ook.1
   complexed with cl, nag

Details for d1ookg_

PDB Entry: 1ook, 2.3 Å

PDB Description: crystal structure of the complex of platelet receptor gpib-alpha and human alpha-thrombin

PDB Compounds: (G:) Platelet glycoprotein Ib alpha chain precursor

SCOPe Domain Sequences for d1ookg_:

Sequence; same for both SEQRES and ATOM records:

>d1ookg_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltql
nldraeltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedt

Timeline for d1ookg_:

• d1ookg_ first appeared in SCOP 1.65
  
• d1ookg_ appears in SCOPe 2.02
  
• d1ookg_ appears in SCOPe 2.04
  
• d1ookg_ appears in the current release, SCOPe 2.08