Lineage for d1ookg_ (1ook G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098754Family c.10.2.7: Ngr ectodomain-like [75142] (7 protein domains)
  6. 2098776Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 2098777Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)
  8. 2098782Domain d1ookg_: 1ook G: [87200]
    Other proteins in same PDB: d1ook.1
    complexed with cl, nag

Details for d1ookg_

PDB Entry: 1ook (more details), 2.3 Å

PDB Description: Crystal Structure of the Complex of Platelet Receptor GPIb-alpha and Human alpha-Thrombin
PDB Compounds: (G:) Platelet glycoprotein Ib alpha chain precursor

SCOPe Domain Sequences for d1ookg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ookg_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltql
nldraeltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedt

SCOPe Domain Coordinates for d1ookg_:

Click to download the PDB-style file with coordinates for d1ookg_.
(The format of our PDB-style files is described here.)

Timeline for d1ookg_: