Lineage for d1oo4a_ (1oo4 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1212958Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1212959Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1212960Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1213223Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 1213224Species Cow (Bos taurus) [TaxId:9913] [55570] (7 PDB entries)
  8. 1213228Domain d1oo4a_: 1oo4 A: [87185]
    N-terminal SH2 domain; complexed to a peptide derived from PDGFR (chain B)
    mutant

Details for d1oo4a_

PDB Entry: 1oo4 (more details)

PDB Description: p395s mutant of the p85 regulatory subunit of the n-terminal src homology 2 domain of pi3-kinase complexed to a peptide derived from pdgfr
PDB Compounds: (A:) phosphatidylinositol 3-kinase regulatory alpha subunit

SCOPe Domain Sequences for d1oo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oo4a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}
gmnnnmslqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnks
ikifhrdgkygfsdsltfnsvvelinhyrneslaqynpkldvkllypvsky

SCOPe Domain Coordinates for d1oo4a_:

Click to download the PDB-style file with coordinates for d1oo4a_.
(The format of our PDB-style files is described here.)

Timeline for d1oo4a_: