SCOP 1.75: Domain d1oo4a_: 1oo4 A:

Lineage for d1oo4a_ (1oo4 A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55570] (7 PDB entries)

8. Domain d1oo4a_: 1oo4 A: [87185]
   N-terminal SH2 domain; complexed to a peptide derived from PDGFR (chain B)
   complexed with ptr; mutant

Details for d1oo4a_

PDB Entry: 1oo4

PDB Description: p395s mutant of the p85 regulatory subunit of the n-terminal src homology 2 domain of pi3-kinase complexed to a peptide derived from pdgfr

PDB Compounds: (A:) phosphatidylinositol 3-kinase regulatory alpha subunit

SCOP Domain Sequences for d1oo4a_:

Sequence; same for both SEQRES and ATOM records:

>d1oo4a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}
gmnnnmslqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnks
ikifhrdgkygfsdsltfnsvvelinhyrneslaqynpkldvkllypvsky

Timeline for d1oo4a_:

• d1oo4a_ first appeared in SCOP 1.65
  
• d1oo4a_ appears in SCOP 1.73
  
• d1oo4a_ appears in SCOPe 2.01
  
• d1oo4a_ appears in the current release, SCOPe 2.08