Lineage for d1onob2 (1ono B:1-125,B:275-300)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308471Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (1 species)
  7. 308472Species Escherichia coli [TaxId:562] [69411] (5 PDB entries)
  8. 308479Domain d1onob2: 1ono B:1-125,B:275-300 [87163]
    Other proteins in same PDB: d1onoa1, d1onoa3, d1onob1, d1onob3
    complexed with mw3

Details for d1onob2

PDB Entry: 1ono (more details), 2.5 Å

PDB Description: IspC Mn2+ complex

SCOP Domain Sequences for d1onob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onob2 c.2.1.3 (B:1-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOP Domain Coordinates for d1onob2:

Click to download the PDB-style file with coordinates for d1onob2.
(The format of our PDB-style files is described here.)

Timeline for d1onob2: